PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00236.1.g00360.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 229aa    MW: 24797.1 Da    PI: 8.7708
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00236.1.g00360.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.11.5e-1869123256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   rk+ ++tkeq   Le+ F+++++++ ++++ LAk+l+L  rqV vWFqNrRa+ k
  Zpz_sc00236.1.g00360.1.sm.mk  69 RKKLRLTKEQSALLEDRFKEHSTLNPKQKAALAKQLNLRPRQVEVWFQNRRARTK 123
                                   788899***********************************************98 PP

2HD-ZIP_I/II125.62.2e-4069158191
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk+rl+keq++lLE+ F+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+
  Zpz_sc00236.1.g00360.1.sm.mk  69 RKKLRLTKEQSALLEDRFKEHSTLNPKQKAALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCETLTEENRRLQ 149
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLreel 91 
                                   +e +eLr +l
  Zpz_sc00236.1.g00360.1.sm.mk 150 RELQELR-AL 158
                                   ******9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.27E-1962126IPR009057Homeodomain-like
PROSITE profilePS5007117.23265125IPR001356Homeobox domain
SMARTSM003899.6E-1667129IPR001356Homeobox domain
PfamPF000466.8E-1669123IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.2E-1869123IPR009057Homeodomain-like
CDDcd000861.17E-1569126No hitNo description
PROSITE patternPS000270100123IPR017970Homeobox, conserved site
SMARTSM003401.1E-23125168IPR003106Leucine zipper, homeobox-associated
PfamPF021831.7E-10125159IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MAREDVHLSD AGLALGLSLG GGGASLPDEA TPATALSVKR ERAEEAEAER ASSTARGAGA  60
EDDDDGTTRK KLRLTKEQSA LLEDRFKEHS TLNPKQKAAL AKQLNLRPRQ VEVWFQNRRA  120
RTKLKQTEVD CEFLKRCCET LTEENRRLQR ELQELRALKL AAPAGAPPSP AVPFYMQLPA  180
ATLSVCPSCD RLGGPAAAKA ADVDRPMGRT ATHHFFNPFA RSALPASAG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16773TRKKLRL
2117125RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0977881e-130FP097788.1 Phyllostachys edulis cDNA clone: bphylf059k15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627844.11e-94PREDICTED: homeobox-leucine zipper protein HOX19 isoform X2
SwissprotA2XE761e-96HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL41e-96HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLW5E4P41e-94W5E4P4_WHEAT; Uncharacterized protein
TrEMBLA0A0E0GEI41e-94A0A0E0GEI4_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NS031e-94A0A0E0NS03_ORYRU; Uncharacterized protein
TrEMBLA0A0D9Z4B91e-94A0A0D9Z4B9_9ORYZ; Uncharacterized protein
STRINGBGIOSGA012175-PA4e-94(Oryza sativa Indica Group)
STRINGLOC_Os03g12860.14e-94(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.13e-49HD-ZIP family protein